PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000280.1_g00006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family FAR1
Protein Properties Length: 623aa    MW: 71792.4 Da    PI: 9.0061
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000280.1_g00006.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR154.63.6e-1724110191
                     FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHn 86 
                              +fY +YAk+ GF v++++sk+  ++g+ +  tf C k  ++e+++k+     +++ +t+t C+ak++ k+ +d+ +++t++el H 
  Itr_sc000280.1_g00006.1  24 EFYTNYAKKKGFGVVTRSSKRG-DDGNLKYFTFACAKAHNKESTSKN---LLSSKLSTKTRCQAKIRFKRCEDESFKITTVELSHD 105
                              6**************9998887.8999**********9999998888...88999******************************* PP

                     FAR1  87 Helap 91 
                              H+l+p
  Itr_sc000280.1_g00006.1 106 HDLSP 110
                              **986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031015.2E-1524110IPR004330FAR1 DNA binding domain
PfamPF105511.0E-39230323IPR018289MULE transposase domain
Sequence ? help Back to Top
Protein Sequence    Length: 623 aa     Download sequence    Send to blast
MEDRERLNEP KVDMVFQSKE EVREFYTNYA KKKGFGVVTR SSKRGDDGNL KYFTFACAKA  60
HNKESTSKNL LSSKLSTKTR CQAKIRFKRC EDESFKITTV ELSHDHDLSP GKARHLRCHR  120
KLNEQVKRRL DINDQAGIAP NKNFRSLVVD AGGYENVTFN EMDCRNYIDE LRRKRLGVGD  180
AEAVCKYFAK MQQSDPNFFY VMDVGEDSRL RNLFWADGRS KAAYESFADV ITFDTTYLTN  240
KYDMPFAPFV GVNHHGQSVL FGCGLLSTED TNSFVWLFQS WLNCMSGRHP KAIITDQCKA  300
MQNAIAIVFP NTKHRWCLWH IMKXIKEALQ SVVYDSLNEN EFENGWSLLI ETYDLNENDW  360
GILCRHALLV LILRKVSEIP SRYILSRWRK DLKRGYTCIR SSYNLSCKET QRCEQMCDAF  420
REVAIIAASE DEKYKRVMDG IKELKSSVMN DEVINSTTQA SCLPQDNGVD KQNMSSGANK  480
VLSPLVTRRK GRPPTKRRVS RLEQMVESLK MKKKRKQIEE KDPKKSRQRQ SSISYDDIDC  540
VPISSSPHKV DEMGTQESFV TTNPMMPLQG FYMVPQQHNV IPTSLDGGHY IPYSSPSNNQ  600
LNSDIQLQAQ VHFNQVWRGV YGT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1495515KRRVSRLEQMVESLKMKKKRK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007199084.11e-147hypothetical protein PRUPE_ppa019160mg, partial
RefseqXP_007214218.11e-147hypothetical protein PRUPE_ppa023217mg
TrEMBLW4ZZ071e-151W4ZZ07_WHEAT; Uncharacterized protein
STRINGBRADI2G36810.11e-147(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1301943
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-70FAR1-related sequence 5